BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00500 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 149 2e-36 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 34 0.14 SB_58081| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_10517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_33922| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) 29 3.9 SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_11954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_34860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) 28 9.0 SB_12134| Best HMM Match : Toxin_4 (HMM E-Value=1.3) 28 9.0 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 149 bits (361), Expect = 2e-36 Identities = 67/85 (78%), Positives = 77/85 (90%) Frame = +1 Query: 253 QVETGVLKPGTIVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYV 432 +VETGVLKPGT+V F+P+NITTEVKSVEMHHE+L EA+PGDNVGFNVKNVSVK+++RG V Sbjct: 125 RVETGVLKPGTVVTFSPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNV 184 Query: 433 AGDSKNNPPKGAADFTAQVIVLNHP 507 AGD KNNPPK FTAQVIV+NHP Sbjct: 185 AGDFKNNPPKPCKSFTAQVIVMNHP 209 Score = 101 bits (241), Expect = 8e-22 Identities = 43/69 (62%), Positives = 55/69 (79%) Frame = +3 Query: 510 QISNGYTPVLDCXTAHIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLC 689 +I GY+PVLDC TAHIACKF ++ EK+DRR+GK E NPK IK+GDAA+V ++PSKP+C Sbjct: 211 EIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMC 270 Query: 690 VESFQNSHP 716 VE+F P Sbjct: 271 VETFTEFPP 279 Score = 93.9 bits (223), Expect = 1e-19 Identities = 44/75 (58%), Positives = 55/75 (73%), Gaps = 6/75 (8%) Frame = +2 Query: 56 NMLEPSTKMPWFKGWQVER------KEGKADGKCLIEALDAILPPARPTXKXLRLPLQDV 217 NM+ +++MPWFK W +ER KE A G L E LD+ILPP+RP+ LRLPLQDV Sbjct: 53 NMITGTSQMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDV 112 Query: 218 YKIGGIGTVPVGKLK 262 YKIGGIGTVPVG+++ Sbjct: 113 YKIGGIGTVPVGRVE 127 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 591 VDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQN 707 +D++TGK + P+ IK AI L +C+E F + Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSD 534 >SB_58081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 32.3 bits (70), Expect = 0.42 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 9/71 (12%) Frame = +1 Query: 199 SSPARRIQNRWYWYRARRQVETGVLKPGTIVVFAPA----NITTEVKSVEMHHEAL---- 354 +SP + N Y YR + + +G+L T + AP +T + +VE+HH Sbjct: 113 ASPTKWTANLRYQYRTTQTISSGLLSVSTTTLVAPGVVRQTVTHDEAAVEVHHLVRVLMD 172 Query: 355 -QEAVPGDNVG 384 +E V G+++G Sbjct: 173 EEERVDGESLG 183 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 31.1 bits (67), Expect = 0.96 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = +3 Query: 555 HIACKFAEIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKP 683 HIA K E+K D ++ K+ ++ PK++ SGD ++VP++P Sbjct: 74 HIAKKL-EVK---DSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_10517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 211 RRIQNRWYWYRARRQVETGVLKPGTIVVFA 300 +R + R YWYRAR+ + G+L P + +V A Sbjct: 60 KRKKVRGYWYRARKPIFLGILLPISWLVIA 89 >SB_33922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 312 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = -3 Query: 416 NSLTDTFFTLKPTLSPGTASWRASWCISTDLTSVVMLAGAKTTMVPGFNTPVSTCRRARY 237 N T T T PT++P + S IS SV+++AG +V TP +RA Y Sbjct: 2 NLTTVTPSTTTPTVTPSDRQYFLSKVISYAAVSVLIIAGNLLCLVVFLRTPQMRRKRAYY 61 >SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2532 Score = 29.5 bits (63), Expect = 2.9 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 6/115 (5%) Frame = +1 Query: 190 APXSSPARRIQNRWYWYRARRQVETGVLKPGTIVVFAPANITTEVKSVEMHH---EALQE 360 AP + + WY++ E LK T F+ + TTE S ++ H E + Sbjct: 174 APLGEEYKNVLEDWYYHDLELAKEVSELKATTAKEFSKLSATTEKMSGDIQHTTEEVSKL 233 Query: 361 AVPGDNVGFNVKNV--SVK-ELRRGYVAGDSKNNPPKGAADFTAQVIVLNHPVKS 516 V + + +++++ S++ + G+VA S GA A +++ V + Sbjct: 234 KVTTEKIAGDIQDIKRSIQGQSSSGHVANISNVTLKDGATSAVADNATVSNTVSA 288 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +1 Query: 190 APXSSPARRIQNRWYWYRARRQVETGVLKPGTIVVFAPANITTEVKSVEMHH 345 AP + + WY++ E L+ T F+ + TTE S ++ H Sbjct: 1572 APLGEECKNVLEDWYYHDLELAKEVSELRVTTAKEFSKLSATTEKMSEDIQH 1623 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 576 LQICRQCGQCXNPILVCNRLRFDRMVKHNDLSCKICS 466 L +C QCGQC +P C ++ ++M+ C C+ Sbjct: 767 LIVCSQCGQCFHP--YCVGVKVNKMILSKGWRCLDCT 801 >SB_22029| Best HMM Match : Copine (HMM E-Value=3.6e-24) Length = 726 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 576 EIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQNSHPS 719 EI R TG++TE+N ++ SG+ I +V + C+ Q P+ Sbjct: 257 EINASHSRETGQTTEIN--ALHSGEPGIPGVVAAYQACIRQVQLYGPT 302 >SB_13701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 6.8 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 44 WHGDNMLEPSTKMPWFKGWQVERKE 118 +H DN + PWF+ W +++E Sbjct: 191 YHNDNKTHSTQTGPWFRAWSNQKRE 215 >SB_11954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +1 Query: 250 RQVETGVLKPGTIVVFAPANITTEVKSVEMHHE-ALQEAVPGDNVGFNVKNVSVKELRRG 426 RQVE + VVF P NI+ + ++ A ++ +P + +KN + R G Sbjct: 3 RQVEFNTIVKE--VVFDPENISVDEGMIKFKGRLAFRQYMPAKPTKYGIKNWMAADARNG 60 Query: 427 YV 432 YV Sbjct: 61 YV 62 >SB_34860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 304 ANITTEVKSVEMHHEALQ-EAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPP 459 A+ TT A+Q E PG ++G + + VKEL++ AG + PP Sbjct: 49 ASATTSTTGSHQAMSAMQSEEEPGASMGHRTERLKVKELKQMKRAGLTPLRPP 101 >SB_21856| Best HMM Match : RVT_1 (HMM E-Value=4.5e-32) Length = 583 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 284 VPGFNTPVSTCRRARYQYH 228 VPG NTP+STC + Y+ Sbjct: 488 VPGDNTPLSTCHNRKVAYY 506 >SB_12134| Best HMM Match : Toxin_4 (HMM E-Value=1.3) Length = 210 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 284 VPGFNTPVSTCRRARYQYH 228 VPG NTP+STC + Y+ Sbjct: 115 VPGDNTPLSTCHNRKVAYY 133 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,666,382 Number of Sequences: 59808 Number of extensions: 577864 Number of successful extensions: 1739 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1732 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -