BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00500 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 3.2 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 5.6 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 23 9.7 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 643 LEMQPLSTWYLPSLYV*SPSRIPTPR 720 LE PL++W LP YV P P + Sbjct: 632 LEPVPLASWQLPPPYVTEPVEGPAKK 657 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = -2 Query: 612 IYQYDGQLFL*FLQICRQCGQCXNPILVCNRLRFDRMVKHNDLSC 478 +YQY + +Q+ C NPI C R R SC Sbjct: 496 VYQYVNSSGIALVQLMAYISSCCNPITYCFMNRRFRQAFLGVFSC 540 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 291 CLCPRQHHY*SQICGDAPRSSPRSC 365 C CP H Y +CG P ++C Sbjct: 22 CACPYAHPYPYDVCG--PNEEFQTC 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,444 Number of Sequences: 2352 Number of extensions: 19133 Number of successful extensions: 48 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -