BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00499 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0449 - 3229260-3229365,3230264-3230396,3230536-3230625,323... 28 4.8 05_04_0137 + 18343106-18344686 27 8.4 >02_01_0449 - 3229260-3229365,3230264-3230396,3230536-3230625, 3231097-3231309,3232317-3232407,3232519-3232707, 3232810-3232920,3233018-3233110 Length = 341 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -2 Query: 465 KMYFMLIYETVNDDERDTSERSRKNARTRLSVTFGRTRRFDVFAVCARAFRILYI 301 KM + ++ TV D ERDT E+ R G T D ARA+R+ Y+ Sbjct: 237 KMEVVPVFITV-DPERDTVEQVRDYVNEFHPNLIGLTGTTDEIRKVARAYRVYYM 290 >05_04_0137 + 18343106-18344686 Length = 526 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 257 LLYILRFEISNIIIFMYKMRNARAHTAK-TSKRRVRPNVTESRVRAFLRER 406 L Y+L F ++ +++F + R R+ AK T+ R PN F+R R Sbjct: 6 LAYVLLFLVTAVLLF-HLRRGGRSAPAKLTTAHRPHPNPVLGNTVEFIRNR 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,249,736 Number of Sequences: 37544 Number of extensions: 107712 Number of successful extensions: 228 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 228 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -