BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00499 (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) fa... 27 5.3 At5g41505.1 68418.m05040 hypothetical protein 27 9.3 >At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 193 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 152 VRSRARTR*SKEKLTDVLVFLTCVCVRCTTVF 247 VRSR R ++E L+ V +FL C C +F Sbjct: 162 VRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF 193 >At5g41505.1 68418.m05040 hypothetical protein Length = 245 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 263 YILRFEISNIIIFMYKMRNARAHTAKTSKRRVRPNVTESRVR 388 +IL+F N I F++ RN R H + S + + VR Sbjct: 179 FILKFVFENAIHFIWTERNDRRHGERPSTTEKMVKLIDKNVR 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,969,478 Number of Sequences: 28952 Number of extensions: 95922 Number of successful extensions: 223 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -