BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00498 (775 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) 124 6e-29 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) 33 0.26 SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) 33 0.34 SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) 31 0.78 SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10) 31 1.4 SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58214| Best HMM Match : DAO (HMM E-Value=0.00017) 29 5.5 SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72) 29 5.5 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_50728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_44895| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 833 Score = 124 bits (300), Expect = 6e-29 Identities = 59/65 (90%), Positives = 62/65 (95%) Frame = +1 Query: 58 VNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRK 237 VNFT D+IRG+MDKK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AGETRFTDTRK Sbjct: 1 VNFTTDQIRGIMDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRK 60 Query: 238 DEQDR 252 DEQDR Sbjct: 61 DEQDR 65 Score = 111 bits (268), Expect = 5e-25 Identities = 58/85 (68%), Positives = 65/85 (76%) Frame = +3 Query: 255 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 434 ITIKSTAIS+++EL E D +IT P ++ E+GFLINLIDSPGHVDFSSEVTAALRVTD Sbjct: 67 ITIKSTAISLYYELPESDFEYITQP--KDPKERGFLINLIDSPGHVDFSSEVTAALRVTD 124 Query: 435 GALXXXXXXXXXXXQTETVLRQAIA 509 GAL QTETVLRQAIA Sbjct: 125 GALVVVDCVSGVCVQTETVLRQAIA 149 Score = 74.9 bits (176), Expect = 6e-14 Identities = 37/70 (52%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +2 Query: 458 CVWCVCTNRNSTA-SGYCERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 634 CV VC + ERIKP+LFMNKMDR YQTF RIVE++NVIIA Sbjct: 132 CVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLDQEDLYQTFARIVESINVIIA 191 Query: 635 TYNDDGGPMG 664 TY+D+ GPMG Sbjct: 192 TYSDEDGPMG 201 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 661 G*VRVDPSKGSVGFGSGLHGWAFTLKQFSEMYA 759 G ++V P KG+V FGSGLHGWAFTLKQ SE+Y+ Sbjct: 201 GNIQVGPEKGTVAFGSGLHGWAFTLKQISEIYS 233 >SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 52.8 bits (121), Expect = 3e-07 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +1 Query: 679 PSKGSVGFGSGLHGWAFTLKQFSEMYA 759 P KG+V FGSGLHGWAFTLKQ SE+Y+ Sbjct: 34 PEKGTVAFGSGLHGWAFTLKQISEIYS 60 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +1 Query: 109 IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 195 +RN S++AHVDHGKSTL D L+ G I+ Sbjct: 1941 VRNFSIVAHVDHGKSTLADRLLEVTGTIS 1969 >SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/85 (22%), Positives = 40/85 (47%) Frame = +1 Query: 55 MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 234 + N+ ++ + +MD IRN+++ H+ GK+ D L + A+ G+ +T Sbjct: 112 LTNYNIEYLADLMDNPELIRNVALAGHLHSGKTAFLDCLFEQTHPELEAKEGKEVMLNTE 171 Query: 235 KDEQDR*SPLNLRPSLCSSSLKRKI 309 + + NL ++C + + R I Sbjct: 172 RLLKHAVQE-NLAITICINKIDRLI 195 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 673 VDPSKGSVGFGSGLHGWAFTLKQFSEMYADN 765 + P G+V F S + + FTL F+++Y D+ Sbjct: 232 ISPLLGNVCFASSSYHFCFTLLSFAKLYVDS 262 >SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0) Length = 359 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/78 (25%), Positives = 34/78 (43%) Frame = +3 Query: 261 IKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 440 IK A S F E+E + + + + + IN++D+PGH DF+ + L D Sbjct: 48 IKKGATSDFMEIERQRGISVAT-SVLAFNYRDKKINILDTPGHKDFAEDTFRTLTAVDSV 106 Query: 441 LXXXXXXXXXXXQTETVL 494 + QTE ++ Sbjct: 107 IVVIDVAKGVEEQTEKLV 124 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +1 Query: 94 DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA 207 D+ + R +I+H D GK+TLT+ L+ G I A A Sbjct: 5 DEIKRRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGA 42 >SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 118 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 219 ++++ HVDHGK+TL D+L + + AG G T+ Sbjct: 31 VTIMGHVDHGKTTLLDAL-RNSSVAAGEAGGITQ 63 Score = 27.9 bits (59), Expect = 9.6 Identities = 17/55 (30%), Positives = 22/55 (40%) Frame = +3 Query: 342 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAI 506 K G I ID+PGH F+S VTD + QT +R A+ Sbjct: 71 KLPSGEKITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGVKTQTVESIRHAM 125 >SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018) Length = 106 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 91 MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 186 M K++ N+ VI HVD GKST T L+ K G Sbjct: 1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32 >SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34) Length = 240 Score = 31.5 bits (68), Expect = 0.78 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 118 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 219 ++V+ HVDHGK++L D + A +I G G T+ Sbjct: 94 VTVMGHVDHGKTSLLD-YIRNANVIEGESGGITQ 126 >SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10) Length = 563 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 503 YCERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIAT 637 + E I+P L +NK+DR + Q+I+E VN I T Sbjct: 126 WLENIRPCLVLNKIDRLITELKYSPSEAFIHLQQILEQVNAITGT 170 >SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1864 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = -1 Query: 475 THTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKL---IKKPFSLFSRWSGFVMNTKS 305 TH+P + TTT AP+ E C G+ ++L K +L R+ G Sbjct: 612 THSPSSTPTTTGAPTTAGFNEFNLEASEDCTGDYVELRDGDSKSAALIGRYCGTNAPMML 671 Query: 304 FSSSSK 287 SS K Sbjct: 672 MGSSDK 677 >SB_58214| Best HMM Match : DAO (HMM E-Value=0.00017) Length = 280 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/83 (22%), Positives = 34/83 (40%) Frame = -1 Query: 496 RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVM 317 R+ S HT + + T V + P L ++ + F WS Sbjct: 31 RAPRSCIRHTTAEELWEREYNNFTDEHTVRKPSNTVFPANMRSLFRRRY--FRHWS-IRK 87 Query: 316 NTKSFSSSSKNIEMAVDLMVING 248 + + FSSSS+N+ D++++ G Sbjct: 88 SMRCFSSSSRNVSKEFDVVIVGG 110 >SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72) Length = 300 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 436 PSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMN 314 P R A TCPGE ++L+ + +RWS V+N Sbjct: 242 PPPERQALACLRHTHTCPGEQLRLVGQ-LGHRARWSSSVIN 281 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 493 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKP 353 ST+ T + STTT A ++ TS + E+ + IKKP Sbjct: 2817 STIGTSRPTSEAFSTTTAATGTIPDSSATSATEGLSDAETEEFIKKP 2863 >SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 Query: 475 THTPDTQSTTTRAPSVTRSAAVTSEEKST 389 T TP+TQSTTT P T+S T E +ST Sbjct: 346 TETPETQSTTT-TPE-TQSTTTTPETQST 372 >SB_50728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.3 bits (60), Expect = 7.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 437 SPCGC*LCVWCVCTNR 484 SPC C+WC C+ R Sbjct: 18 SPCALYFCIWCECSKR 33 >SB_44895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 710 PDPKPTEPLLGSTRTHPWDHHHRYMW 633 P P T P +T THPW + + W Sbjct: 198 PAPTVTHPWTTTTVTHPWSRPYCHSW 223 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,497,614 Number of Sequences: 59808 Number of extensions: 538419 Number of successful extensions: 1708 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1699 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -