BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00495 (821 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pomb... 31 0.15 SPAC3A11.03 |||methyltransferase |Schizosaccharomyces pombe|chr ... 28 1.8 SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac... 26 5.6 SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 9.8 SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schi... 25 9.8 >SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 31.5 bits (68), Expect = 0.15 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 555 ERQESWLQNHPFAKCANMDLPVYQRVI-IQILAFIAAHTFGIRLIYPGSLFLIH 713 +R+E WL P+ L + R++ AF +HT G ++YP FL+H Sbjct: 664 KRREPWLYGEPYTSLVRELLRIRYRLLPTWYTAFYNSHTHGFPILYP--QFLMH 715 >SPAC3A11.03 |||methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 247 Score = 27.9 bits (59), Expect = 1.8 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 406 AYGRSYSPKYLKFIDTLDSPMDDKNAYL 489 AY R++ Y +F+D++DS +++N L Sbjct: 81 AYTRAFLKSYFRFLDSIDSGHNERNEAL 108 >SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor complex subunit, Fip1 homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 26.2 bits (55), Expect = 5.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 300 PIHNPTWLSFNGRSKNFNA 356 P HNPT NG S N+NA Sbjct: 283 PTHNPTSSYGNGASTNYNA 301 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 812 RYGFRRKCRSWRAPRCRLDEL 750 RY R CR P+C LD L Sbjct: 1176 RYELERACRILSDPKCNLDHL 1196 >SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schizosaccharomyces pombe|chr 2|||Manual Length = 766 Score = 25.4 bits (53), Expect = 9.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 229 LFNSDRAIRILLSSIEVNLVESRRKH 152 LFN D ++I++ +I N ESR +H Sbjct: 145 LFNMDALLQIVMFNIYGNQYESREEH 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,582,261 Number of Sequences: 5004 Number of extensions: 76561 Number of successful extensions: 178 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 402440190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -