BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00495 (821 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41930| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.4e-10) 31 1.1 SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 >SB_41930| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.4e-10) Length = 597 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = +1 Query: 181 LRWTTRGSVSPGRS*KDW*KDPCNGYTAIRIGYYATPLICLYIIQRGFLSM 333 LRW +++P + K+P +G A+ + Y + PL+ L+++ GF+ M Sbjct: 220 LRWPGGAAMTPRDVSQPVTKNPPSGGEAVEV-YISVPLVILFVVCGGFIGM 269 >SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1784 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 492 GDQEIRFDFSAWPVTFTADPEERQESWL 575 G Q R + S WP + +P+ ++ SWL Sbjct: 74 GPQRARLNLSKWPQGYRGNPKSQENSWL 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,938,301 Number of Sequences: 59808 Number of extensions: 565215 Number of successful extensions: 1179 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1179 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -