BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00495 (821 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 pr... 26 1.2 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 25 2.8 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.9 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 24 6.5 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 8.6 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 8.6 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 8.6 >AY745211-1|AAU93478.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 26.2 bits (55), Expect = 1.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 744 RTQLVESTTGSAPRSALPTETISRQC 821 RT ES+TG P ++LP +R C Sbjct: 9 RTNAAESSTGRTPSASLPFAIGARSC 34 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 25.0 bits (52), Expect = 2.8 Identities = 11/54 (20%), Positives = 25/54 (46%) Frame = -3 Query: 498 DRLQIRILVVHGRVQSVNEFQIFRTVRSSICSHYEENSSYTADASEEAH*SFYF 337 D + ++ + VHG V + ++ +R +I + + + A E H ++F Sbjct: 269 DPMYVKAVTVHGEVYHLTWINHYKAIRKAIGIEWPGYMIHESGAWSEVHRRWFF 322 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 4.9 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 412 HMLALRRKQ*LYSRCLRRSALKFLLLPLKESHVGLCIGRSM 290 H+L L+ + L +R R A++ + SHV +C+ SM Sbjct: 771 HVLVLKENRQLANRVHRLLAMRVVRAYKTISHVAVCVIASM 811 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 6.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 681 DEYRRYGPQ*KPKFGL 634 D+YR YGP + +FG+ Sbjct: 39 DQYRPYGPSIQNRFGI 54 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 23.4 bits (48), Expect = 8.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 123 TVDPMMMRYKQSNIEFSF*LCLIE 52 TV M+R++ +N+EF F L L E Sbjct: 238 TVFVHMLRWQLANLEFEFHLSLAE 261 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 8.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 295 ICLYIIQRGFLSMEEVKTLMRFFGGI 372 +C Y+ + G + ++TLM F GG+ Sbjct: 381 LCKYVPEPGDAYVVPIRTLMLFGGGL 406 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.4 bits (48), Expect = 8.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 12 YLRGRTAAPRIFLFQLSRVKRKIQYYSAYNASSWGLLWLE*GVC 143 YLR + R+F +QL+ + +KI+ + LLW E C Sbjct: 255 YLRFGCLSTRLFYYQLTDLYKKIKKACPPLSLHGQLLWREFFYC 298 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 903,657 Number of Sequences: 2352 Number of extensions: 19352 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -