BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00490 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|c... 27 3.3 SPAC5D6.09c |mug86||acetate transporter |Schizosaccharomyces pom... 26 5.8 >SPAC31A2.12 |||arrestin/PY protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 596 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -3 Query: 415 QKHHNENYLVLKARFATQNYTSYNNNNR---YIYVLHILVP 302 Q+H+ + Y+V + + YT N R Y Y H+++P Sbjct: 79 QRHNKQEYVVYEKNWIFVPYTGANRTLRAGNYEYPFHVMLP 119 >SPAC5D6.09c |mug86||acetate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 304 Score = 25.8 bits (54), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 567 LFPVLLNLRNEYSD*NEFQYSVSL 496 +F N++N Y D N+F Y++ L Sbjct: 168 IFIPWFNIQNSYDDPNDFNYAIGL 191 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,379,491 Number of Sequences: 5004 Number of extensions: 44278 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -