BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00489 (751 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 7.6 AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-tran... 23 7.6 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 287 LELCNSAISVCTVTRVIWQFILSSASINFP 198 L +++S + R+IWQ + A + FP Sbjct: 338 LRQLQASLSSAELDRLIWQMKMHKAIVQFP 367 >AF515526-1|AAM61893.1| 229|Anopheles gambiae glutathione S-transferase protein. Length = 229 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -1 Query: 313 ILEPRMYTFSSCATRPSL---YVLLRESFGNSYYPQ 215 I +PRM + C RP+L +RES N YY Q Sbjct: 177 IEQPRMAGYDPCEGRPNLTQWMARVRES-TNPYYDQ 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 745,820 Number of Sequences: 2352 Number of extensions: 13914 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -