BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00482 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 100 6e-23 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 7.9 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 100 bits (239), Expect = 6e-23 Identities = 51/69 (73%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = +2 Query: 509 PAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDSAAVLRR 688 PAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFD Sbjct: 7 PAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFD 66 Query: 689 VH-LTIEDG 712 V LTI++G Sbjct: 67 VSILTIDEG 75 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.5 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 72 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 173 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 186 SVLCCVHRHRASHRRCRQEPGGDNPNNTI 272 SVL C + R C P G N N ++ Sbjct: 10 SVLGCAYTQRTKCAACLDSPDGMNGNESL 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 911,377 Number of Sequences: 2352 Number of extensions: 20594 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -