BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00481 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 27 0.67 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 27 0.89 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 25 2.0 AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 pr... 25 2.0 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 25 2.0 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 2.7 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 25 3.6 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 24 6.3 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 6.3 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 6.3 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 23 8.3 AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A prot... 23 8.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 8.3 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 27.1 bits (57), Expect = 0.67 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +3 Query: 51 KLTPRKFLIMSASPIARQATHSQ---SIPSRRVLITDPAQMPDVYSSTPGGTIYSTTP 215 + TP +ASP A S+ + PS R LI A ++TP T STTP Sbjct: 668 RTTPTTTTTTTASPAPAPAIRSRFGDNRPSWRPLIVPHATTTKTPTTTPPATTTSTTP 725 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 26.6 bits (56), Expect = 0.89 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = +3 Query: 63 RKFLIMSASPIARQATHSQSIPS--RRVLITDPAQMPDVYSSTPGGTIYSTTPG 218 RK L SA PIA + PS RR P+ + S+ GG + PG Sbjct: 689 RKLLTESAPPIAPMSPRPNRFPSRPRRQQQHQPSALAGCSGSSSGGLARNGVPG 742 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 290 QCALPAALLKNPSSVPNVQPASTQKP 367 QC PA P PN +PAS P Sbjct: 68 QCDYPAQAQCAPGVTPNTEPASKPSP 93 >AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 protein. Length = 83 Score = 25.4 bits (53), Expect = 2.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 201 YSTTPGGTRIVYERSFMLPFGN 266 +S GGT++ E+ LPFG+ Sbjct: 12 FSPATGGTKVYREKGCFLPFGD 33 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 290 QCALPAALLKNPSSVPNVQPASTQKP 367 QC PA P PN +PAS P Sbjct: 68 QCDYPAQAQCAPGVTPNTEPASKPSP 93 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 177 SSTPGGTIYSTTPGG 221 S+ PGG +YST P G Sbjct: 20 SAAPGGGVYSTGPAG 34 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 173 LFQHTGRNHLLNYSWRYKNSV 235 +F + G+NHL+N R K+ V Sbjct: 144 IFSYKGKNHLINKDIRCKDDV 164 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 198 IYSTTPGGTRIVYERSFMLP 257 +Y T GTR +R+F LP Sbjct: 78 LYQVTDSGTREAVQRAFYLP 97 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 236 VHYSCTSRSS*VDGSARCAGIDIRHLS 156 + SC + S VDGS+ + I+I +L+ Sbjct: 676 IDMSCANGSDQVDGSSGASAINIHYLN 702 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 284 PPQCALPAALLKNPSSVPNVQPASTQKPRS 373 PP +P P +VP +QP +P S Sbjct: 221 PPGVPMPMRPQMPPGAVPGMQPGMQPRPPS 250 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 290 QCALPAALLKNPSSVPNVQPASTQKP 367 QC PA P PN +PA P Sbjct: 68 QCDYPAQAQCAPGVTPNTEPAPKPSP 93 >AY344824-1|AAR02435.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 Query: 290 QCALPAALLKNPSSVPNVQPASTQKP 367 QC PA P PN +PA P Sbjct: 68 QCDYPAQAQCAPGVTPNTEPAPKPSP 93 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 8.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 126 PSRRVLITDPAQMPDVYSSTPGGTIYSTTP 215 PS R LI A ++TP T STTP Sbjct: 697 PSWRPLIVPHATTTKTPTTTPPATTTSTTP 726 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 841,179 Number of Sequences: 2352 Number of extensions: 17615 Number of successful extensions: 33 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -