BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00478 (731 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0982 + 7627420-7628141,7628190-7628643,7629167-7629823,762... 31 1.2 02_05_1227 - 35076047-35076217,35076737-35076797,35077038-350771... 29 2.9 02_04_0651 - 24737953-24738114,24738205-24738375,24738534-247386... 29 5.0 11_01_0788 + 6599962-6602700 28 6.6 09_01_0028 + 486800-486890,486928-488009,488825-489190,489342-48... 28 8.8 02_02_0344 + 9182775-9183539,9195912-9196028 28 8.8 >06_01_0982 + 7627420-7628141,7628190-7628643,7629167-7629823, 7629975-7630469 Length = 775 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +1 Query: 64 NKPVYHYVKLPEKEMSFLKQNASTINTYWFIDCVLYDNTIDFSFNYTYGDV--MSSHHV 234 N+P H++ + +K+ S + +T I + D+T DF YT GD + +H+V Sbjct: 16 NEPPVHHLLVDDKDKSETYFPINPTDTSMEIPAINLDDTFDFETMYTAGDAGSLQAHNV 74 >02_05_1227 - 35076047-35076217,35076737-35076797,35077038-35077123, 35077213-35077301,35077685-35077766,35078094-35078136, 35078211-35078284,35078492-35078561,35078747-35078816, 35079275-35079369,35079473-35079549,35080725-35080760 Length = 317 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 726 TWYWTQ*SNGGDPAYVTLRSNKSPCCSQFRPLILTVVIGSLTLTIC 589 ++ WTQ + P V L+ N++ C Q+ P +GS ++C Sbjct: 38 SYVWTQEGHDWVPTLVILKLNRAALCVQWSPKENKFAVGSGAKSVC 83 >02_04_0651 - 24737953-24738114,24738205-24738375,24738534-24738632, 24738738-24738938,24739234-24739341,24739531-24739810, 24739962-24740089 Length = 382 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 37 DRPNSFVAVNKPVYHYVK--LPEKEMSFLKQNASTINTYWFI 156 DR + K VYH +K +PE S+LK ++ + W + Sbjct: 235 DRGVQVIMNEKEVYHMLKSQIPENRASYLKLSSDNVPQLWIV 276 >11_01_0788 + 6599962-6602700 Length = 912 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +2 Query: 587 EQIVSVREPITTVNISGRNWLQHGDLLDLKVTYAGSPPFDYCVQYQ 724 E+I+ + + I WLQ DL+ +TY F C+ Q Sbjct: 120 EEIIQIEKKIENAGKRKERWLQQPDLIPNPLTYIERKQFQDCLLAQ 165 >09_01_0028 + 486800-486890,486928-488009,488825-489190,489342-489692 Length = 629 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 148 WFIDCVLYDNTIDFSFNYTYGDV--MSSHHV 234 W I + D T DF YT GDV + +H+V Sbjct: 32 WMIPAINLDYTFDFETMYTSGDVGSLQAHNV 62 >02_02_0344 + 9182775-9183539,9195912-9196028 Length = 293 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +1 Query: 64 NKPVYHYVKLPEKEMSFLKQNASTINTYWFIDCVLYDNTIDFSFNYTYGDV--MSSHHV 234 N+P H++ + +++ + + +T I + D+T DF YT GD + +H+V Sbjct: 16 NEPPVHHLLVDDEDRNETYFPINLTDTSMEIPAINLDDTFDFETMYTTGDAGSLQAHNV 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,301,406 Number of Sequences: 37544 Number of extensions: 255990 Number of successful extensions: 549 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -