BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00478 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 25 1.8 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 24 4.2 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 67 KPVYHYVKLPEKEMSFLKQNASTINTYWFIDCVL 168 KP H+ + EK LK + Y+F D VL Sbjct: 49 KPTIHFAYIIEKLYKRLKSKGDYVGIYFFRDPVL 82 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 24.2 bits (50), Expect = 4.2 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -2 Query: 694 RSCVRDLKIQ*ISVL*PISATNINCCYRLSNTDYLFKSPDCVIFTDSN 551 RS +DLK+ ++ P AT ++L + ++ +PD +F N Sbjct: 79 RSLKQDLKLASSDIVVPAGATITVATFKLHRLESIYPNPD--VFNPDN 124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,004 Number of Sequences: 2352 Number of extensions: 13157 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -