BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00478 (731 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130539-1|AAI30540.1| 734|Homo sapiens family with sequence si... 30 7.4 BC130513-1|AAI30514.1| 734|Homo sapiens family with sequence si... 30 7.4 AY457926-1|AAR20839.1| 734|Homo sapiens cancer associated nucle... 30 7.4 AB058774-1|BAB47500.2| 821|Homo sapiens KIAA1871 protein protein. 30 9.8 >BC130539-1|AAI30540.1| 734|Homo sapiens family with sequence similarity 111, member B protein. Length = 734 Score = 30.3 bits (65), Expect = 7.4 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 408 IKQGSTAATEPSPATVIKNSTEVHKIKKRGISNRLQRKRQQ 530 IKQ +A E + ++I++ +VHK KK G + ++ R+Q Sbjct: 283 IKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQ 323 >BC130513-1|AAI30514.1| 734|Homo sapiens family with sequence similarity 111, member B protein. Length = 734 Score = 30.3 bits (65), Expect = 7.4 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 408 IKQGSTAATEPSPATVIKNSTEVHKIKKRGISNRLQRKRQQ 530 IKQ +A E + ++I++ +VHK KK G + ++ R+Q Sbjct: 283 IKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQ 323 >AY457926-1|AAR20839.1| 734|Homo sapiens cancer associated nucleoprotein protein. Length = 734 Score = 30.3 bits (65), Expect = 7.4 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +3 Query: 408 IKQGSTAATEPSPATVIKNSTEVHKIKKRGISNRLQRKRQQ 530 IKQ +A E + ++I++ +VHK KK G + ++ R+Q Sbjct: 283 IKQNESATDEINHQSLIQSKKKVHKPKKDGETKDVEHSREQ 323 >AB058774-1|BAB47500.2| 821|Homo sapiens KIAA1871 protein protein. Length = 821 Score = 29.9 bits (64), Expect = 9.8 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 1/98 (1%) Frame = +2 Query: 416 RIHCSDRTFTGH-CN*KFYGSS*N*KKRYFEQTSKKTPAVYKCNNTITVGENYTVGRFEQ 592 R+H ++ + H C F G + K + K + +C T + E R EQ Sbjct: 329 RLHSGEKPYECHRCGKTFSGRTAFLKHQRLHAGEK----IEECEKTFSKDEEL---REEQ 381 Query: 593 IVSVREPITTVNISGRNWLQHGDLLDLKVTYAGSPPFD 706 + E N GRN+ DL+ +VT+ G P++ Sbjct: 382 RIHQEEKAYWCNQCGRNFQGTSDLIRHQVTHTGEKPYE 419 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,648,258 Number of Sequences: 237096 Number of extensions: 1536317 Number of successful extensions: 6509 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6509 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -