BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00475 (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) 36 0.036 SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) 36 0.036 SB_9811| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_44547| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-11) 28 7.1 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 28 9.4 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +2 Query: 686 KKRAPWLILPVVICLSQRLSHACL 757 ++ A WLILPVVICLSQRLSHACL Sbjct: 126 RRVAIWLILPVVICLSQRLSHACL 149 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +2 Query: 686 KKRAPWLILPVVICLSQRLSHACL 757 ++ A WLILPVVICLSQRLSHACL Sbjct: 102 RRVAIWLILPVVICLSQRLSHACL 125 >SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) Length = 171 Score = 35.9 bits (79), Expect = 0.036 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +2 Query: 686 KKRAPWLILPVVICLSQRLS 745 ++ A WLILPVVICLSQRLS Sbjct: 147 RRVAIWLILPVVICLSQRLS 166 >SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) Length = 147 Score = 35.9 bits (79), Expect = 0.036 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +2 Query: 686 KKRAPWLILPVVICLSQRLS 745 ++ A WLILPVVICLSQRLS Sbjct: 123 RRVAIWLILPVVICLSQRLS 142 >SB_9811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/51 (21%), Positives = 29/51 (56%) Frame = +3 Query: 417 YFIWCFYLNIICFNVNGLCEISVDRFCIIILSLKIKFSRIWIFIYLMILFI 569 +F+W IC ++ L +++ R +I+ K + ++FI++++++I Sbjct: 103 WFVWPTMTVTICLSIFTLTSMAIHRRKVILNPFKPEIKHRYVFIWIVVIWI 153 >SB_44547| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-11) Length = 332 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 432 FYLNIICFNVNGLCEISVDRFCIIILSLKIKFSRIWIFIYLMILF 566 FY + +V LC ++ DRF I+ LK + +++++LF Sbjct: 112 FYDMAVIASVFNLCALTYDRFLAIVHPLKYQLVMTRTRVFILLLF 156 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = -2 Query: 171 ATRKTNEHMKNFKISRTKKFMRPITKVSSSPQCIYVKLLTGQDIYERWIDTSD 13 AT K+N+ ++ + T + + + + PQC + G+D+ + DT D Sbjct: 442 ATSKSNQGVRKAEEKGTHQIDVQVMESTDIPQCHATNAIAGEDVKAKKEDTED 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,984,555 Number of Sequences: 59808 Number of extensions: 355186 Number of successful extensions: 726 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -