BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00474 (701 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC113608-1|AAI13609.1| 522|Homo sapiens chromosome 6 open readi... 31 3.0 BC113606-1|AAI13607.1| 522|Homo sapiens chromosome 6 open readi... 31 3.0 BC108714-1|AAI08715.1| 522|Homo sapiens chromosome 6 open readi... 31 3.0 BC012928-1|AAH12928.1| 473|Homo sapiens C6orf150 protein protein. 31 3.0 AL603910-3|CAI14879.1| 447|Homo sapiens chromosome 6 open readi... 31 3.0 AL603910-2|CAI14878.1| 522|Homo sapiens chromosome 6 open readi... 31 3.0 AL603910-1|CAO03612.1| 505|Homo sapiens chromosome 6 open readi... 31 3.0 AK097148-1|BAC04965.1| 522|Homo sapiens protein ( Homo sapiens ... 31 3.0 AK122587-1|BAC56928.1| 749|Homo sapiens FLJ00412 protein protein. 30 9.2 >BC113608-1|AAI13609.1| 522|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 522 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >BC113606-1|AAI13607.1| 522|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 522 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >BC108714-1|AAI08715.1| 522|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 522 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >BC012928-1|AAH12928.1| 473|Homo sapiens C6orf150 protein protein. Length = 473 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 304 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 355 >AL603910-3|CAI14879.1| 447|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 447 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >AL603910-2|CAI14878.1| 522|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 522 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >AL603910-1|CAO03612.1| 505|Homo sapiens chromosome 6 open reading frame 150 protein. Length = 505 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >AK097148-1|BAC04965.1| 522|Homo sapiens protein ( Homo sapiens cDNA FLJ39829 fis, clone SPLEN2012800. ). Length = 522 Score = 31.5 bits (68), Expect = 3.0 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = -1 Query: 437 SYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 S R +++E+I+ + I+KRK G+P +LL+ I+VD + +A+ +KSS Sbjct: 278 SKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEK--ISVD--ITLALESKSS 329 >AK122587-1|BAC56928.1| 749|Homo sapiens FLJ00412 protein protein. Length = 749 Score = 29.9 bits (64), Expect = 9.2 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 12 RSLFRRCFGTPPCDGGVSRLHLPGYLW 92 RS+FRR PP + SRL L LW Sbjct: 91 RSIFRRVLSAPPKESRTSRLRLSKALW 117 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,954,861 Number of Sequences: 237096 Number of extensions: 2279298 Number of successful extensions: 4320 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4320 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8119219030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -