BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00474 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g58227.1 68414.m06616 hypothetical protein 30 1.3 At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pin... 30 1.7 At4g04480.1 68417.m00650 hypothetical protein 27 9.1 >At1g58227.1 68414.m06616 hypothetical protein Length = 1323 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 294 GDGVVNCYDYMAIHKKGGYGCTGELPFNYV--NVFNQCINV 410 GDG + + +M+ + KG + G+ +YV N+ QC+NV Sbjct: 486 GDGKMGIFSFMSKNGKGCFAALGKDGLSYVSLNLKRQCVNV 526 >At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 91 GCKQGLQCEGETCGLFRITWGYWADAGKPTING 189 GC + L E L R WGYW GK NG Sbjct: 257 GCGKVLVMVAEKDALVRQGWGYWEKLGKSRWNG 289 >At4g04480.1 68417.m00650 hypothetical protein Length = 398 Score = 27.5 bits (58), Expect = 9.1 Identities = 23/82 (28%), Positives = 42/82 (51%) Frame = -1 Query: 449 SIRQSYLRSVLREDIDALVKHVYIVKRKFAGAPVASLLVDRHVVIAVDHSVAVAVLAKSS 270 SI+++ L +VL E +D + H I ++ SLL++ +I + ++ + + + Sbjct: 67 SIQRTRLNAVLEEVMDRIEMHKNIGDQRNNWN---SLLLNSVNMITLTAALMAGIASVNG 123 Query: 269 HVVLDVCAAQYGSTVQLE*ASG 204 H V V A + STV L A+G Sbjct: 124 HGVDSVTAVKIASTVLLTSATG 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,363,213 Number of Sequences: 28952 Number of extensions: 325644 Number of successful extensions: 757 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -