BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00467 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) 28 8.5 SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) 28 8.5 >SB_9894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 411 FSHDSKIIMTPFRVNTIFIVIRFPMINSRFVL 316 F HDSKI +R I I++ FP+I F L Sbjct: 201 FLHDSKIATKIYRELQIIIIVLFPIIAFIFYL 232 >SB_17097| Best HMM Match : F-box (HMM E-Value=3.8) Length = 408 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 525 SIIHYCETKQQLNEHSYCALYKSIIEIL 442 +++ YC K LN SYC YKS + +L Sbjct: 275 NVLSYCPYKSYLNVLSYCP-YKSYLNVL 301 >SB_15167| Best HMM Match : F-box (HMM E-Value=3.8) Length = 392 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 525 SIIHYCETKQQLNEHSYCALYKSIIEIL 442 +++ YC K LN SYC YKS + +L Sbjct: 223 NVLSYCPYKSYLNVLSYCP-YKSYLNVL 249 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,284,645 Number of Sequences: 59808 Number of extensions: 288771 Number of successful extensions: 496 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -