BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00467 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 3.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.6 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 590 CITLIDKFCSINDNIKAKTRLLARR 664 C+ +D+FC+I +K + RR Sbjct: 133 CMISVDRFCAITKPLKYGVKRTPRR 157 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +3 Query: 189 FFIIYKQNIKLFSIYLVFLFVELLILYFVAFYL 287 F+II ++ +++ L+ V + L + FYL Sbjct: 225 FYIIIRRKTLFYTVNLILPTVLISFLCVLVFYL 257 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,531 Number of Sequences: 438 Number of extensions: 3220 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -