BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00464 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 24 1.7 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 24 1.7 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 23 3.8 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 8.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.8 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 180 GAAQHYCLHCARYFIDEQALNDHFK 254 G ++C HC R F+ L H + Sbjct: 34 GEKPYHCSHCDRQFVQVANLRRHLR 58 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 556 NRKLC-LCHSLFRLSRKISEHK 618 N +C LCH +FR ++ HK Sbjct: 400 NSAVCALCHKVFRTLNSLNNHK 421 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 547 CQGNRKLCLCHSLFRLSRKISE 612 C G R +C + + +KISE Sbjct: 266 CYGGRNRKICEAFVKTGKKISE 287 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 493 KHETYCNPKKIFSSFHQWCQGNRKL 567 KH NP K+ F GN++L Sbjct: 178 KHAVKFNPAKVKLRFENLFDGNKEL 202 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 566 YVYVTPYLDFPEKFQNINNIKDDLKKRKYNYN 661 Y++ T EKF+ + I+DD+ + N Sbjct: 549 YIWFTTSGTISEKFRKLIRIEDDVATLRMKLN 580 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,095 Number of Sequences: 438 Number of extensions: 3529 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -