BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00464 (718 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein ... 48 6e-06 At1g54920.2 68414.m06269 expressed protein 31 1.0 At1g54920.1 68414.m06270 expressed protein 31 1.0 At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive eff... 30 1.8 At5g54460.1 68418.m06782 wound-responsive protein-related contai... 29 2.3 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 28 5.4 At3g05670.1 68416.m00631 PHD finger family protein contains Pfam... 28 7.1 At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 28 7.1 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 28 7.1 At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-conta... 28 7.1 At1g28430.1 68414.m03495 cytochrome P450, putative similar to cy... 28 7.1 At1g13630.1 68414.m01601 pentatricopeptide (PPR) repeat-containi... 28 7.1 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 27 9.4 At4g02405.1 68417.m00325 expressed protein 27 9.4 At2g41940.1 68415.m05188 zinc finger (C2H2 type) family protein ... 27 9.4 At2g19610.2 68415.m02291 zinc finger (C3HC4-type RING finger) fa... 27 9.4 At2g19610.1 68415.m02290 zinc finger (C3HC4-type RING finger) fa... 27 9.4 At1g56660.1 68414.m06516 expressed protein 27 9.4 At1g02040.1 68414.m00124 zinc finger (C2H2 type) family protein ... 27 9.4 >At2g36930.1 68415.m04529 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain; weak similarity to Zinc finger protein T86 (Swiss-Prot:O00488) [Homo sapiens] Length = 198 Score = 48.0 bits (109), Expect = 6e-06 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +3 Query: 159 KVDLDLPGAAQHYCLHCARYFIDEQALNDHFKQK 260 ++D DLPG Q YCLHC RYF + +DHFK K Sbjct: 47 QLDEDLPGMGQFYCLHCDRYFSNVSVRDDHFKTK 80 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 171 DLPGAAQHYCLHCARYFIDEQALNDHFKQK 260 DLPG Q CL C R F + ++ HFK K Sbjct: 131 DLPGMGQFNCLLCHRNFSNASVMDYHFKTK 160 >At1g54920.2 68414.m06269 expressed protein Length = 890 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +3 Query: 9 DQTDMTYKRK--KYHCGDTHLKKRWRVRNRKKDLDEIDQ-DLKEENAEKLLNQKV 164 D D+ +K K YH HL+K R++ D DE+ + D + E+ + LLN V Sbjct: 573 DYQDLFHKLKIELYHIALYHLEKLKEARDKAADSDEVQKCDSEIEDLQNLLNNDV 627 >At1g54920.1 68414.m06270 expressed protein Length = 430 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +3 Query: 9 DQTDMTYKRK--KYHCGDTHLKKRWRVRNRKKDLDEIDQ-DLKEENAEKLLNQKV 164 D D+ +K K YH HL+K R++ D DE+ + D + E+ + LLN V Sbjct: 237 DYQDLFHKLKIELYHIALYHLEKLKEARDKAADSDEVQKCDSEIEDLQNLLNNDV 291 >At5g37160.1 68418.m04461 tRNA-splicing endonuclease positive effector-related contains similarity to SEN1, a positive effector of tRNA-splicing endonuclease [Saccharomyces cerevisiae] gi|172574|gb|AAB63976 Length = 871 Score = 29.9 bits (64), Expect = 1.8 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 6/89 (6%) Frame = +3 Query: 9 DQTDMTYKRKKYHCGDTHLKKRWRVRNRKKDLDE-----IDQ-DLKEENAEKLLNQKVDL 170 D + T + + H + L++ +K++++E +D DL + ++ K Sbjct: 407 DFLENTETKYEQHVNELELERMTEDEKKKEEVEERTMQEVDMADLSTHLPKSFISSKDVK 466 Query: 171 DLPGAAQHYCLHCARYFIDEQALNDHFKQ 257 +L A Q LH RYF+ E + D FK+ Sbjct: 467 NLIAACQ--ALHRVRYFLQENSSRDDFKK 493 >At5g54460.1 68418.m06782 wound-responsive protein-related contains weak similarity to KED [Nicotiana tabacum] gi|8096269|dbj|BAA95789 Length = 141 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +3 Query: 12 QTDMTYKRKKYHCGDTHLKKRWRVRNRKKDLDEIDQDLKEENAEKLLNQK 161 + D+ R+KY G T LKK + RK ++ +KEE AE + +K Sbjct: 73 ELDLQKGREKYK-GATRLKKEKKKWERKNKRNQSKSPVKEEGAEPVKEEK 121 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 39 KYHCGDTHLKKRWRVRNRK-KDLDEIDQDLKEENAEKLLNQK 161 K GDT+L +++ R+ K ++ ID+DL +E + + LN+K Sbjct: 1045 KEEFGDTNLVGWSKMKAREGKHMEVIDEDLLKEGSSESLNEK 1086 >At3g05670.1 68416.m00631 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 883 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +3 Query: 30 KRKKYHCGDTHLKK--RWRVRNRKKDLDEIDQDLKEE 134 +RKK T L + + RVRN KK +DE D D ++ Sbjct: 275 RRKKCSVAKTRLTRGRKRRVRNTKKGVDEDDDDFVDD 311 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 99 DLDEIDQDLKEENAEKLLNQKVDLDLPG 182 DL+ +Q+LK E + +NQ V +D+ G Sbjct: 29 DLENTNQELKSELKDLYINQAVQMDISG 56 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 99 DLDEIDQDLKEENAEKLLNQKVDLDLPG 182 DL+ +Q+LK E + +NQ V +D+ G Sbjct: 29 DLENTNQELKSELKDLYINQAVQMDISG 56 >At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9UBS4 DnaJ homolog subfamily B member 11 precursor Homo sapiens; contains Pfam profile PF00226 DnaJ domain Length = 300 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 63 LKKRWRVRNRKKDLDEIDQDLKEENAEKLLNQKVDLDLPGA 185 L++ V N+KK +IDQ L+EE L+ ++DL + GA Sbjct: 167 LERTGGVSNKKKGSKQIDQKLQEE-----LSNELDLQIKGA 202 >At1g28430.1 68414.m03495 cytochrome P450, putative similar to cytochrome P450 (CYP93A1) GI:1435059 from [Glycine max] Length = 521 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/54 (27%), Positives = 32/54 (59%) Frame = -2 Query: 189 VLLLADLNQLFGSVIFQHFLPLNLGLFHPNLSFCYALSTAFLNVCRHNDISCAY 28 +LL A +++ F + ++ L+L +FH + + STA+ ++ + NDI+ +Y Sbjct: 55 LLLFASIHKCFQKISSKYGPFLHLRIFHVPIVLVSSASTAY-DIFKTNDINVSY 107 >At1g13630.1 68414.m01601 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 764 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +2 Query: 602 KFQNINNIKDDLKKRKYN---YNFEKLEELWHVYEELKQK 712 K QN+N + + YN Y+F + +++W VY+E+K K Sbjct: 131 KDQNLN-----VSTQSYNSVLYHFRETDKMWDVYKEIKDK 165 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 99 DLDEIDQDLKEENAEKLLNQKVDLDLPG 182 DL+ +Q+LK E + +NQ V +D+ G Sbjct: 29 DLENTNQELKSELKDLYINQAVHMDISG 56 >At4g02405.1 68417.m00325 expressed protein Length = 333 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 159 KVDLDLPGAAQHYCLHCARYFIDEQAL 239 K DLD+ QHYCL A FID++ L Sbjct: 99 KKDLDIHEQQQHYCL--ATKFIDDKLL 123 >At2g41940.1 68415.m05188 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 257 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 105 DEIDQDLKEENAEKLLNQKVDLDLPGAAQHYCLHCARYFIDEQALNDH 248 DE +++K+++ EK ++ D D + C +C R F QAL H Sbjct: 68 DESSENIKDKDKEK--DKDKDKDNNNNRRFECHYCFRNFPTSQALGGH 113 >At2g19610.2 68415.m02291 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 418 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -2 Query: 117 GLFHPNLSFCYALSTAFLNVCRHNDISCAYMSCRSDLVP 1 G FH C + + R N C Y C +DLVP Sbjct: 220 GCFHRICVTCMRKPFSSEQILRGNTAICPYPDCENDLVP 258 >At2g19610.1 68415.m02290 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 397 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -2 Query: 117 GLFHPNLSFCYALSTAFLNVCRHNDISCAYMSCRSDLVP 1 G FH C + + R N C Y C +DLVP Sbjct: 220 GCFHRICVTCMRKPFSSEQILRGNTAICPYPDCENDLVP 258 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +3 Query: 90 RKKDLDEIDQDLKEENAEKLLNQKVDLD 173 +KK+ DE DQ++KE++++K N+K + D Sbjct: 231 KKKEHDETDQEMKEKDSKK--NKKKEKD 256 >At1g02040.1 68414.m00124 zinc finger (C2H2 type) family protein contains Pfam profile: PF00096 zinc finger, C2H2 type Length = 324 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +3 Query: 33 RKKYHCGDTHLKKRWRVRNRKKDLDEIDQDLKEENAEKLLNQKVDLDLPGAAQHYCLHCA 212 +K C + K+ K+D D+ D+D EE E+ + + H C C Sbjct: 173 KKVKGCFASQDKEEEEEEEYKEDDDDNDEDEDEEEDEED-KSTAHIARKRSNAHECTICH 231 Query: 213 RYFIDEQALNDH 248 R F QAL H Sbjct: 232 RVFSSGQALGGH 243 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,296,706 Number of Sequences: 28952 Number of extensions: 255365 Number of successful extensions: 911 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -