BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00462 (773 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1523 + 27432991-27433199,27433585-27434185,27434468-274346... 28 7.2 06_01_0173 - 1364219-1364836,1364941-1365123,1365215-1365470,136... 28 9.5 >07_03_1523 + 27432991-27433199,27433585-27434185,27434468-27434642, 27434686-27436418,27436871-27437317 Length = 1054 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 345 KAPKLFGWWFRRPTSWWSEIPCVFFAMFIIV 253 + P+ WW RR S WS + + F ++ Sbjct: 330 RKPRTCNWWPRRAISLWSPVVAILLLAFAVL 360 >06_01_0173 - 1364219-1364836,1364941-1365123,1365215-1365470, 1365551-1366120,1367066-1367178,1367344-1367816, 1367906-1367984 Length = 763 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/62 (29%), Positives = 26/62 (41%) Frame = -3 Query: 351 WTKAPKLFGWWFRRPTSWWSEIPCVFFAMFIIVESIRVWNNNEKKFSKAQNQPMKLKGLF 172 W+ G P + + FF + I+ I W N F KAQN P+ GLF Sbjct: 297 WSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIAYWFN----FYKAQNFPIFSDGLF 352 Query: 171 ST 166 ++ Sbjct: 353 TS 354 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,223,611 Number of Sequences: 37544 Number of extensions: 266964 Number of successful extensions: 612 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -