BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00462 (773 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35540| Best HMM Match : IF3_N (HMM E-Value=4.4e-07) 29 3.2 >SB_35540| Best HMM Match : IF3_N (HMM E-Value=4.4e-07) Length = 284 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 233 FHTLIDSTIINMAKNTQGISDHQEVGLLNHQPKSLGALV 349 +H + D + + K + +EVG+L+ QPKS+G+LV Sbjct: 224 YHKISDEEKLEIVKKV--VDGVKEVGVLDGQPKSVGSLV 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,978,279 Number of Sequences: 59808 Number of extensions: 303591 Number of successful extensions: 596 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -