BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00462 (773 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64180.1 68414.m07270 intracellular protein transport protein... 29 4.5 At3g01060.3 68416.m00009 expressed protein 28 6.0 At3g01060.2 68416.m00007 expressed protein 28 6.0 At3g01060.1 68416.m00008 expressed protein 28 6.0 >At1g64180.1 68414.m07270 intracellular protein transport protein USO1-related similar to Rap8 (GI:2326183) [Rhynchosciara americana]; contains weak similarity to Swiss-Prot:P25386 intracellular protein transport protein USO1 [Saccharomyces cerevisiae] Length = 593 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 287 ISDHQEVGLLNHQPKSLGAL---VHLALGPHHHLWE 385 ++D+ + L +HQP+S G++ + L HHHL E Sbjct: 117 VADNNGIELTDHQPESAGSIRRQIGQMLMKHHHLTE 152 >At3g01060.3 68416.m00009 expressed protein Length = 372 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 396 TAAASHRWW*GPRARWTKAPKLFGWWFRRPTSWWSEIPCVFFAMF 262 T A H+ + GP +R K PK W R SW +P FF +F Sbjct: 164 TFAYEHKIFVGPFSR--KFPKAQVWVAPRQWSWPLNLPLEFFGIF 206 >At3g01060.2 68416.m00007 expressed protein Length = 442 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 396 TAAASHRWW*GPRARWTKAPKLFGWWFRRPTSWWSEIPCVFFAMF 262 T A H+ + GP +R K PK W R SW +P FF +F Sbjct: 159 TFAYEHKIFVGPFSR--KFPKAQVWVAPRQWSWPLNLPLEFFGIF 201 >At3g01060.1 68416.m00008 expressed protein Length = 455 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 396 TAAASHRWW*GPRARWTKAPKLFGWWFRRPTSWWSEIPCVFFAMF 262 T A H+ + GP +R K PK W R SW +P FF +F Sbjct: 164 TFAYEHKIFVGPFSR--KFPKAQVWVAPRQWSWPLNLPLEFFGIF 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,832,829 Number of Sequences: 28952 Number of extensions: 229354 Number of successful extensions: 566 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -