BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00456 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 1.8 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 24 4.2 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 5.6 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.7 AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 23 9.7 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +1 Query: 370 LFSMHLNTFCICLQLVVSG-YFRS 438 LF+M L+TF IC+ ++V +FRS Sbjct: 307 LFTMILDTFSICVTVIVLNIHFRS 330 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.2 bits (50), Expect = 4.2 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 385 LNTFCICLQLVVSGYFRSWTS-TTPEAEPNRCLLYYKYIQGGCGIYVA 525 L T C+C+ L+V + W S P EP L Y + + G I+ A Sbjct: 15 LATLCLCVYLLVVRKYSFWRSYHVPYVEPE--LPYGNFKEMGKSIHPA 60 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -1 Query: 226 NTVTALRNEKVHRYFSRRSLNLETFTFDR 140 NT+T RN+++ +Y + + F +R Sbjct: 301 NTLTRTRNQQIQKYLCEQKRKIGEFEVER 329 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 9.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 Query: 277 VGNAILVIKINHNA*YNNTVTALRNEKVHRYFSRRSLNLET 155 V N I H+ Y NT+ LRNE V + L + T Sbjct: 582 VDNPSNTINERHDQRYANTLQELRNEMVMQKEGENELTVLT 622 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 206 PKSGNCIIILCIMVYFDNKYSVSYST 283 PK N I +L YFD Y+V YST Sbjct: 77 PKKMNSIRLL----YFDMSYNVIYST 98 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,539 Number of Sequences: 2352 Number of extensions: 16009 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -