BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00454 (747 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 29 0.15 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 25 1.9 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.15 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = +1 Query: 76 ETIDDMPLDNTFINKSNVDSQVKSILYNNVVSPKDERAWLMKAITLIDLTTLSGDDTSSK 255 E D +P+ + + D ++ I ++ ERA + T +D TL GD SSK Sbjct: 603 EDPDSIPMISKLKYEEQYDKALRYIFGKTLICRNLERATELAKSTGLDCVTLEGDQVSSK 662 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 25.4 bits (53), Expect = 1.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 511 VVIDRSLVLTGEWETLFNEIQ 573 +++ +L G WET FNE Q Sbjct: 253 MIVANALYFRGTWETFFNEPQ 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,580 Number of Sequences: 2352 Number of extensions: 17179 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -