BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00443 (723 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 23 1.9 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 23 2.5 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 3.3 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 181 GHRWRDDGRQEIVRSKRQ 128 GH W+ D +E VR++ Q Sbjct: 117 GHEWQADVSEEAVRARMQ 134 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 536 TGLSDGNSSPFFVAAGVLGAITVSTPSEDNRDS 438 T G S V +GV+ + V E+N DS Sbjct: 59 TATQTGESEMMVVTSGVIPGVAVDFLGENNDDS 91 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 498 GSRSPGSDHGQH 463 G+RSPG DH ++ Sbjct: 14 GARSPGGDHSEN 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,671 Number of Sequences: 336 Number of extensions: 3337 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -