BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00441 (340 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 3.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 4.1 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 5.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 5.4 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 20 7.1 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 21.4 bits (43), Expect = 3.1 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -3 Query: 245 VRASSPARNYTGCEFYKKLQTKCTKSSDRCCCCPG 141 +R P+R + G EF K+ + K PG Sbjct: 80 IRPGQPSRQHAGFEFGKEYKNGFIKGQSEVQRGPG 114 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.0 bits (42), Expect = 4.1 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 305 KNLHCGRYQHRN 270 +N CGRY ++N Sbjct: 415 RNTRCGRYHNQN 426 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 20.6 bits (41), Expect = 5.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 82 YILYTL*NSKSEICRFPKCAPGQQQQRSLDFVHF 183 Y LYT N E+C A Q+ ++F+ F Sbjct: 79 YFLYTSKNDNEEVCGIYFLAE-PDQKIEINFITF 111 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 5.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 31 LYHLKDGYEYIRSKMLCYI 87 L+ L EY+RSK++ ++ Sbjct: 175 LHDLDQSQEYVRSKLVDFL 193 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.2 bits (40), Expect = 7.1 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -3 Query: 158 CCCCPG 141 C CCPG Sbjct: 406 CACCPG 411 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,873 Number of Sequences: 438 Number of extensions: 1761 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7715466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -