BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00439 (596 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC042813-1|AAH42813.1| 155|Homo sapiens FUN14 domain containing... 53 9e-07 BC035015-1|AAH35015.1| 155|Homo sapiens FUN14 domain containing... 53 9e-07 AL136137-1|CAI40461.1| 155|Homo sapiens FUN14 domain containing... 53 9e-07 AL022163-1|CAI42944.1| 155|Homo sapiens FUN14 domain containing... 53 9e-07 BC067852-1|AAH67852.1| 151|Homo sapiens FUN14 domain containing... 44 3e-04 BX470111-10|CAI41659.1| 189|Homo sapiens FUN14 domain containin... 44 4e-04 BX470111-9|CAI41658.1| 218|Homo sapiens FUN14 domain containing... 44 4e-04 BC108657-1|AAI08658.1| 189|Homo sapiens FUN14 domain containing... 44 4e-04 BC072685-1|AAH72685.1| 189|Homo sapiens FUN14 domain containing... 44 4e-04 BC000255-1|AAH00255.2| 189|Homo sapiens FUN14 domain containing... 44 4e-04 AY032594-1|AAK51136.1| 189|Homo sapiens hepatitis C virus core-... 44 4e-04 AJ272054-1|CAC81242.1| 189|Homo sapiens hypothetical protein pr... 44 4e-04 AF320778-1|AAN51931.1| 189|Homo sapiens cervical cancer oncogen... 44 4e-04 AK002022-1|BAA92041.1| 397|Homo sapiens protein ( Homo sapiens ... 34 0.44 BC120997-1|AAI20998.1| 475|Homo sapiens solute carrier family 2... 32 1.3 BC120996-1|AAI20997.1| 475|Homo sapiens solute carrier family 2... 32 1.3 BC041575-1|AAH41575.1| 456|Homo sapiens SLC29A3 protein protein. 32 1.3 AY358686-1|AAQ89049.1| 475|Homo sapiens AVVS717 protein. 32 1.3 AY288928-1|AAP41133.1| 475|Homo sapiens equilibrative nucleosid... 32 1.3 AL359384-1|CAI16088.1| 475|Homo sapiens solute carrier family 2... 32 1.3 AL359183-1|CAI13424.1| 475|Homo sapiens solute carrier family 2... 32 1.3 AF326987-1|AAK00958.1| 475|Homo sapiens equilibrative nucleosid... 32 1.3 >BC042813-1|AAH42813.1| 155|Homo sapiens FUN14 domain containing 1 protein. Length = 155 Score = 52.8 bits (121), Expect = 9e-07 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 328 SQKGYIDINWDKINKKVDKISDKIEKEATGKSPD---WFEKVFVFVKSNSYYSAGFTGGF 498 S GY+ I+W ++ K V+K +I+K A +P+ E+ F+K N S+GF GGF Sbjct: 90 SHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGF 149 Query: 499 LFGM 510 L G+ Sbjct: 150 LLGL 153 >BC035015-1|AAH35015.1| 155|Homo sapiens FUN14 domain containing 1 protein. Length = 155 Score = 52.8 bits (121), Expect = 9e-07 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 328 SQKGYIDINWDKINKKVDKISDKIEKEATGKSPD---WFEKVFVFVKSNSYYSAGFTGGF 498 S GY+ I+W ++ K V+K +I+K A +P+ E+ F+K N S+GF GGF Sbjct: 90 SHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGF 149 Query: 499 LFGM 510 L G+ Sbjct: 150 LLGL 153 >AL136137-1|CAI40461.1| 155|Homo sapiens FUN14 domain containing 1 protein. Length = 155 Score = 52.8 bits (121), Expect = 9e-07 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 328 SQKGYIDINWDKINKKVDKISDKIEKEATGKSPD---WFEKVFVFVKSNSYYSAGFTGGF 498 S GY+ I+W ++ K V+K +I+K A +P+ E+ F+K N S+GF GGF Sbjct: 90 SHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGF 149 Query: 499 LFGM 510 L G+ Sbjct: 150 LLGL 153 >AL022163-1|CAI42944.1| 155|Homo sapiens FUN14 domain containing 1 protein. Length = 155 Score = 52.8 bits (121), Expect = 9e-07 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +1 Query: 328 SQKGYIDINWDKINKKVDKISDKIEKEATGKSPD---WFEKVFVFVKSNSYYSAGFTGGF 498 S GY+ I+W ++ K V+K +I+K A +P+ E+ F+K N S+GF GGF Sbjct: 90 SHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGF 149 Query: 499 LFGM 510 L G+ Sbjct: 150 LLGL 153 >BC067852-1|AAH67852.1| 151|Homo sapiens FUN14 domain containing 2 pseudogene protein. Length = 151 Score = 44.4 bits (100), Expect = 3e-04 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +1 Query: 328 SQKGYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGG 495 + GYI ++W ++ K + K ++++ + + P+ E+V FVK N + GF GG Sbjct: 85 NHSGYIKVDWQRVEKDMKKAKEQLKIPKSTQIPNQVRSKAEEVVSFVKKNVLVTGGFFGG 144 Query: 496 FLFGM 510 FL GM Sbjct: 145 FLLGM 149 >BX470111-10|CAI41659.1| 189|Homo sapiens FUN14 domain containing 2 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >BX470111-9|CAI41658.1| 218|Homo sapiens FUN14 domain containing 2 protein. Length = 218 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 155 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 214 Query: 505 GM 510 GM Sbjct: 215 GM 216 >BC108657-1|AAI08658.1| 189|Homo sapiens FUN14 domain containing 2 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >BC072685-1|AAH72685.1| 189|Homo sapiens FUN14 domain containing 2 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >BC000255-1|AAH00255.2| 189|Homo sapiens FUN14 domain containing 2 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >AY032594-1|AAK51136.1| 189|Homo sapiens hepatitis C virus core-binding protein 6 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >AJ272054-1|CAC81242.1| 189|Homo sapiens hypothetical protein protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >AF320778-1|AAN51931.1| 189|Homo sapiens cervical cancer oncogene 3 protein. Length = 189 Score = 44.0 bits (99), Expect = 4e-04 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 337 GYIDINWDKINKKVDKISDKIEKEATGKSPDWF----EKVFVFVKSNSYYSAGFTGGFLF 504 GYI ++W ++ K + K ++++ + + P E+V FVK N + GF GGFL Sbjct: 126 GYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLL 185 Query: 505 GM 510 GM Sbjct: 186 GM 187 >AK002022-1|BAA92041.1| 397|Homo sapiens protein ( Homo sapiens cDNA FLJ11160 fis, clone PLACE1007014, weakly similar to 36 KD NUCLEOLAR PROTEIN HNP36. ). Length = 397 Score = 33.9 bits (74), Expect = 0.44 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -3 Query: 237 AVPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 AVP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 34 AVPSMLCLVANFLLVNRVAVHIRVLASLTVILA 66 >BC120997-1|AAI20998.1| 475|Homo sapiens solute carrier family 29 (nucleoside transporters), member 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >BC120996-1|AAI20997.1| 475|Homo sapiens solute carrier family 29 (nucleoside transporters), member 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >BC041575-1|AAH41575.1| 456|Homo sapiens SLC29A3 protein protein. Length = 456 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 94 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 125 >AY358686-1|AAQ89049.1| 475|Homo sapiens AVVS717 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >AY288928-1|AAP41133.1| 475|Homo sapiens equilibrative nucleoside transporter type 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >AL359384-1|CAI16088.1| 475|Homo sapiens solute carrier family 29 (nucleoside transporters), member 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >AL359183-1|CAI13424.1| 475|Homo sapiens solute carrier family 29 (nucleoside transporters), member 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 >AF326987-1|AAK00958.1| 475|Homo sapiens equilibrative nucleoside transporter 3 protein. Length = 475 Score = 32.3 bits (70), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 234 VPKISCLVAEVLPISAMALSIKFLASSTIFLA 139 VP + CLVA L ++ +A+ I+ LAS T+ LA Sbjct: 113 VPSMLCLVANFLLVNRVAVHIRVLASLTVILA 144 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,640,868 Number of Sequences: 237096 Number of extensions: 1110567 Number of successful extensions: 2276 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2263 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -