BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00439 (596 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49130-5|CAA88970.1| 138|Caenorhabditis elegans Hypothetical pr... 28 5.8 AF067613-9|AAN73863.2| 326|Caenorhabditis elegans Serpentine re... 28 5.8 >Z49130-5|CAA88970.1| 138|Caenorhabditis elegans Hypothetical protein T06D8.7 protein. Length = 138 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/58 (27%), Positives = 24/58 (41%) Frame = +1 Query: 334 KGYIDINWDKINKKVDKISDKIEKEATGKSPDWFEKVFVFVKSNSYYSAGFTGGFLFG 507 KGYI +N KI + + + + + +GK FV + GF G L G Sbjct: 79 KGYITLNESKIERDMKNLHKSVMNKVSGKKV--INISDSFVSEYRWILGGFAAGMLIG 134 >AF067613-9|AAN73863.2| 326|Caenorhabditis elegans Serpentine receptor, class z protein20 protein. Length = 326 Score = 27.9 bits (59), Expect = 5.8 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -3 Query: 408 FFFNFITDLINFFVYFIPININVAFLACN 322 F +++ ++I F + +PI + +++L CN Sbjct: 261 FDIDYVLEIIPFDCFLLPIIVQISYLGCN 289 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,068,140 Number of Sequences: 27780 Number of extensions: 195586 Number of successful extensions: 647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -