BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00432 (665 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 36 3e-04 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 35 5e-04 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 35 5e-04 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 28 0.060 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.0 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.0 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 22 3.9 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 3.9 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 5.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.1 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 35.9 bits (79), Expect = 3e-04 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +1 Query: 589 INEPTAAAIAYGLDKRVLENEM 654 INEPTAAAIAYGLDK+ E + Sbjct: 1 INEPTAAAIAYGLDKKGAEQNI 22 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 35.1 bits (77), Expect = 5e-04 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 589 INEPTAAAIAYGLDKR 636 INEPTAAAIAYGLDK+ Sbjct: 1 INEPTAAAIAYGLDKK 16 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 35.1 bits (77), Expect = 5e-04 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 589 INEPTAAAIAYGLDKR 636 INEPTAAAIAYGLDK+ Sbjct: 1 INEPTAAAIAYGLDKK 16 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 28.3 bits (60), Expect = 0.060 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +2 Query: 182 DHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLI--GRKFEDATVQADMKHWPFEV 355 DH + +H + SH +QEP G +N F RL+ D + ADM + + Sbjct: 342 DHQAM--LHHNPMSHH-LKQEPSGFTSSNHPFSINRLLPTAESKADIKMYADMHQYGYNT 398 Query: 356 VS 361 +S Sbjct: 399 LS 400 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 134 LPAREGGDHRQRPGQQDH 187 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 544 TKDAGTISGLNVLRIINEPTAA 609 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 466 RSLSWQNCAECSYHVPAYFN 525 RS Q C C YH P N Sbjct: 29 RSTISQGCKACGYHSPLESN 48 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +1 Query: 466 RSLSWQNCAECSYHVPAYFNDSQRQATKDAGTISGLNVLRII 591 R+ + N A+ H PA + TK++G ++ V ++ Sbjct: 336 RTFTLSNTAKFGVHAPASGGGKEGTYTKESGFLAYYEVCELL 377 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 5.2 Identities = 11/55 (20%), Positives = 25/55 (45%) Frame = +1 Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKRVLENEMY 657 +CS + P ++ ++ K + + L ++ I N P G+ + ++ N Y Sbjct: 65 DCSKNSPEKESEEKKSKEKPPYSYNALIMMAIRNSPEKRLTLNGIYEYIMRNFPY 119 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -3 Query: 510 NVITAFCTVLPR*ASAVSFIF 448 ++ITAF +VLP+ A +++ F Sbjct: 86 DLITAFLSVLPQLAWDITYRF 106 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 133 TPTQEYVVPRSIPT 92 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,325 Number of Sequences: 336 Number of extensions: 3702 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -