BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00427 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 24 1.5 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 24 1.5 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.6 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 40 NSNLEVNHGHQQVVYHQVSGAGTYVFVRRS 129 N N E N+ H +YH+V Y R S Sbjct: 32 NQNTEQNYTHNNEMYHRVKEEPIYESCRFS 61 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 40 NSNLEVNHGHQQVVYHQVSGAGTYVFVRRS 129 N N E N+ H +YH+V Y R S Sbjct: 32 NQNTEQNYTHNNEMYHRVKEEPIYESCRFS 61 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 40 NSNLEVNHGHQQVVYHQVSGAGTYVFVRRS 129 N N E N+ H +YH V Y R S Sbjct: 32 NQNTEHNYTHNNEMYHSVKEEPIYESCRFS 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,077 Number of Sequences: 336 Number of extensions: 3877 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -