BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00427 (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 26 1.1 Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease prot... 25 2.5 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 4.3 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 23 10.0 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 26.2 bits (55), Expect = 1.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -1 Query: 555 RWNSHY*ADHSNPNKTHCICMQHLKSFSDCAALFCVRSLASSLR 424 RWNSHY + H K A L CVR ASS++ Sbjct: 51 RWNSHYDLFLGKNDSILITIYNHRKMPKRQAFLGCVRIAASSIQ 94 >Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease protein. Length = 268 Score = 25.0 bits (52), Expect = 2.5 Identities = 14/64 (21%), Positives = 26/64 (40%) Frame = +2 Query: 119 CVALHYHSYNADADIGMLVTGTFVGYLIIFAGAAAGYIMQTPSHKRSTSSIRWSVLPCSS 298 C +++ AD++I GT G + +G + G ++Q + W +PC Sbjct: 189 CRKIYFTETVADSNI---CAGTMEGTSSVCSGDSGGPLVQIDDEIVQVGIVSWGGIPCGG 245 Query: 299 LAVP 310 P Sbjct: 246 YKNP 249 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 478 GFQMLHTNTMRLIRITMVRLIM*IPPQSLLP 570 GFQ + NT RL + + M +PP LP Sbjct: 781 GFQQVVNNTNRLYTPQLNHISMRMPPVPFLP 811 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 5 DENDIGEKRRLAF---LDLMIETANNGANISDEE 35 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 5 DENDIGEKRRLAF---LDLMIETANNGANISDEE 35 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 10.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 390 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 289 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 753,171 Number of Sequences: 2352 Number of extensions: 15612 Number of successful extensions: 64 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -