BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00425 (714 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.9 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.5 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 5.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.5 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 9.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +2 Query: 260 SSDEVKCIEEEGE-DDNTASQETL 328 S+DEVK ++EG+ +D S E L Sbjct: 14 STDEVKVFKDEGDGEDEKRSSENL 37 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.0 bits (47), Expect = 2.5 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -2 Query: 248 SSGMIPAVWSEAGAGRQVLLHAAVHAGTEVELHVESFF*KRIFGGIFVEHN 96 SS + PAV + GAG ++ + T V L + +F G+F E + Sbjct: 280 SSLLEPAVGTMTGAGGTAIVSISTSVSTSVYLAI-------VFNGLFTEED 323 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 97 LCSTKIPPKIRFQKKDSTWSSTS 165 LC KI K R K++ T STS Sbjct: 367 LCGMKIVKKRRKDKREITRKSTS 389 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.5 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = -2 Query: 452 CDVNYISVWDR 420 CD+ ++ VW+R Sbjct: 712 CDLGWVEVWER 722 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +3 Query: 291 KGKMTTQPVKKLYNL 335 +G +T+ +KKL+NL Sbjct: 125 RGDVTSTTIKKLFNL 139 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,793 Number of Sequences: 336 Number of extensions: 2569 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -