BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00419 (777 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po... 30 0.32 SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyce... 27 2.3 SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.9 SPAC1142.08 |fhl1|SPAC8C9.01|fork head transcription factor Fhl1... 26 6.9 SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyc... 26 6.9 SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schiz... 26 6.9 >SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 30.3 bits (65), Expect = 0.32 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +2 Query: 143 SPILLDDSPDTLTENTPKSVTAAES*EENSRTSTHVTSSDSG 268 S I+ PD+ +E+TP S + A S S TST TS SG Sbjct: 223 SSIISAAPPDSASESTPASTSYASS--TTSATSTSTTSGSSG 262 >SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 27.5 bits (58), Expect = 2.3 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 76 LTSCDVSHLETTTPDPPPKPYV---FSYTAGRFPGHVDREHTE 195 L S V L +PDPP P + S P HV R++T+ Sbjct: 444 LPSASVPALGDGSPDPPAAPSIQNSLSVHESEMPPHVTRDYTQ 486 >SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 364 Score = 27.5 bits (58), Expect = 2.3 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 61 VLAAGLTSCDVSHLETTTPDPPPKPYVFSYTAGRFPGHVD--REHTEVSDGSG 213 V+ AG S +SH + T P + + F Y A R+ + REH + D G Sbjct: 107 VIEAGTGSASMSHAISRTVGPLGRLFTFEYHATRYQTALQEFREHEMLIDVGG 159 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.8 bits (54), Expect = 6.9 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 303 LSDVPPEHP--ADSESVALAKDRHFQLYSKIAEEHAQHPHP 419 L + EH AD ES+ +A+D + + +AEE+ + P Sbjct: 2561 LQQLSAEHNRHADLESMVMARDDYINVQQPLAEENQEEGSP 2601 >SPAC1142.08 |fhl1|SPAC8C9.01|fork head transcription factor Fhl1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 325 TRLTLNP*PWLKTGTSSYTPRLLKSTPNIHILMKPAFLVNQPPSPKP 465 T LNP P T+ P + +P+I + +PA V PP +P Sbjct: 547 TSQQLNPAP-----TAMPHPNITSPSPSISVTQRPAVNVGPPPYVRP 588 >SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 735 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 372 QLYSKIAEEHAQHPHPYETSVPRQSAAVAEATLKHSEL 485 +L+ + A A+HP Y+T V SA AE+T H L Sbjct: 176 RLFIQSAHNIAKHPSLYDTEVRNPSA--AESTNSHVSL 211 >SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/57 (26%), Positives = 21/57 (36%) Frame = +1 Query: 4 HERKRTSNK*TMLCHTLILVLAAGLTSCDVSHLETTTPDPPPKPYVFSYTAGRFPGH 174 H SN + C L + + + L+ + P P P F Y A R GH Sbjct: 17 HNNACQSNASSSACRASEDHLVSSFPNDSIIDLQPSRPAPEPPKKKFGYYARRLSGH 73 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,749,919 Number of Sequences: 5004 Number of extensions: 50243 Number of successful extensions: 164 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -