BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00418 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 24 1.5 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 24 1.5 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 3.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 3.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 4.6 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 Query: 318 FNCFYI*KLLHN 283 FNCF++ KLL+N Sbjct: 367 FNCFWVMKLLYN 378 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 604 IIEFLKKLQNCIKSIN*IQKNTKNSLNIILRQIRINDLM 488 +IEF KLQN IN + T++ +++ +R + + + Sbjct: 109 LIEFDVKLQNVSLIINYENQRTRSRIHLFVRYVFVTSYL 147 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 547 KNTKNSLNIILRQIRINDLMDRKIDPATVI 458 K+ +NS NI L + + DLM + TV+ Sbjct: 97 KDMRNSTNIFLVNLSVADLMVLLVCTPTVL 126 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 547 KNTKNSLNIILRQIRINDLMDRKIDPATVI 458 K+ +NS NI L + + DLM + TV+ Sbjct: 97 KDMRNSTNIFLVNLSVADLMVLLVCTPTVL 126 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = -1 Query: 195 GAHVGCPSG*LSRGFIEPHV-HSVRIPRLH 109 G H G G G EPHV H + LH Sbjct: 11 GIHPGYMDGGAGAGLYEPHVAHRPGLQGLH 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,931 Number of Sequences: 336 Number of extensions: 3797 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -