BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00418 (759 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16E8.03 |gna1|spgna1|glucosamine-phosphate N-acetyltransfera... 31 0.18 SPBC25H2.06c |hrf1||COPII-coated vesicle component Hrf1 |Schizos... 28 1.7 SPCC1739.01 ||SPCC1906.05|zf-CCCH type zinc finger protein|Schiz... 27 3.8 SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizo... 26 5.1 SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1||... 25 8.9 >SPAC16E8.03 |gna1|spgna1|glucosamine-phosphate N-acetyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 111 Score = 31.1 bits (67), Expect = 0.18 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 10 VTVSLLAQELGCYKMSLDCKDKLIKFYETLG 102 +T+ LA L YK+ LDC D + FYE G Sbjct: 64 LTLIKLAFSLNSYKVILDCSDSNVGFYEKCG 94 >SPBC25H2.06c |hrf1||COPII-coated vesicle component Hrf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 27.9 bits (59), Expect = 1.7 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 10 VTVSLLAQELGCYKMSLDCKDKLIKFYETLGYKMEPGNSNAMNMRFDEP 156 V V LA LGCY +++ + +++ GYK +++ F+ P Sbjct: 180 VLVEFLATRLGCYLLNISSQSQVLDLLAFSGYKFVGLILTSLSKLFEMP 228 >SPCC1739.01 ||SPCC1906.05|zf-CCCH type zinc finger protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 26.6 bits (56), Expect = 3.8 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +3 Query: 579 CNFFRNSIIIADNNC-FE---D*KR*FVNYFLMG-CPIGHGC 689 C FFRN A NC F + +R YFL G C G C Sbjct: 47 CKFFRNGTCTAGENCPFSHSLETERPICKYFLKGNCKFGPKC 88 >SPBC146.09c |lsd1|swm1, saf110|histone demethylase SWIRM1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1000 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 485 IHQIIDSYLSQYNVQRIFGIFLYLIY*FNA 574 +H I + + +VQRIF +F L++ FNA Sbjct: 380 LHDIENGRIDTEHVQRIFRLFDALLFYFNA 409 >SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 25.4 bits (53), Expect = 8.9 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +3 Query: 417 AFYVDCVACLVVCVITVAGSIFLSIKSLIRICR-NIMFKEFLVFFCI*FIDLMQFCNFFR 593 A Y C+A L V + A +F ++R C +I F++ V F L+ FF Sbjct: 168 AIYACCMA-LTVFINPNALLLFFPSYLILRKCNSSIKFRQIFVVFLFYLAGLIITSGFFL 226 Query: 594 NSI 602 NS+ Sbjct: 227 NSL 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,038,541 Number of Sequences: 5004 Number of extensions: 62613 Number of successful extensions: 136 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -