BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00418 (759 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012179-1|AAH12179.1| 184|Homo sapiens glucosamine-phosphate N... 38 0.030 AK090577-1|BAC03482.1| 184|Homo sapiens protein ( Homo sapiens ... 38 0.030 >BC012179-1|AAH12179.1| 184|Homo sapiens glucosamine-phosphate N-acetyltransferase 1 protein. Length = 184 Score = 38.3 bits (85), Expect = 0.030 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 13 TVSLLAQELGCYKMSLDCKDKLIKFYETLGYKMEPGN 123 T++LL+++L CYK++L+C + + FY+ GY + N Sbjct: 140 TLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEEN 176 >AK090577-1|BAC03482.1| 184|Homo sapiens protein ( Homo sapiens cDNA FLJ33258 fis, clone ASTRO2005687, highly similar to Mus musculus mRNA for EMeg32 protein. ). Length = 184 Score = 38.3 bits (85), Expect = 0.030 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 13 TVSLLAQELGCYKMSLDCKDKLIKFYETLGYKMEPGN 123 T++LL+++L CYK++L+C + + FY+ GY + N Sbjct: 140 TLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEEN 176 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,121,419 Number of Sequences: 237096 Number of extensions: 1870185 Number of successful extensions: 2593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2593 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -