BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00417 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.4 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.4 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 9.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 582 CFCTMATLPGQWRRTATPDFIQILTISHAL 671 C C+M LPG +T+T ++ +I+ + + + Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIMDLDNVM 713 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 86 SVSDTPSLKDLPKVATDLKS 145 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +2 Query: 134 DLKSQLEGFNTSCLRDVDTNEKIV 205 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.7 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 724 CIVPNFLCHFLNVI 765 C+VP+F+ F+ V+ Sbjct: 124 CVVPSFVADFVKVL 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,423 Number of Sequences: 438 Number of extensions: 4596 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -