BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00414 (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 24 4.1 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 24 4.1 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 23 7.2 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 9.5 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/53 (24%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 551 SMNVMSLRSC-VKRAASLMTAALCSTARNMDLSTLGGRFRLRSSMYNLINTFY 706 ++ ++ + +C ++ LM +L S ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFS-ARNCFVESMLASGSLHQGMYNVLQEWY 131 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/53 (24%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 551 SMNVMSLRSC-VKRAASLMTAALCSTARNMDLSTLGGRFRLRSSMYNLINTFY 706 ++ ++ + +C ++ LM +L S ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFS-ARNCFVESMLASGSLHQGMYNVLQEWY 131 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 474 SRLCAVPSSSSPTSKDLRIKEVGF 545 S +C P PTS L + VGF Sbjct: 240 SPVCLPPDDFPPTSPGLNVTAVGF 263 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 110 RYTPTEPRFRIRFIFAVPVASCWPAP 33 R TP+ PR VP +S W P Sbjct: 48 RSTPSSPRLAQASTCPVPCSSIWSRP 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 832,888 Number of Sequences: 2352 Number of extensions: 17647 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -