BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00413 (523 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0217 + 2337950-2338085,2340766-2342436,2342636-2342898,234... 27 6.9 10_07_0079 + 12665141-12665167,12665613-12665702,12665783-126663... 27 9.1 >10_01_0217 + 2337950-2338085,2340766-2342436,2342636-2342898, 2343027-2343236,2343436-2343654,2344038-2345000, 2345279-2345374,2345482-2345580,2345953-2346142, 2346594-2346823 Length = 1358 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 249 DESLFADPFGMFGGENHMAIMGPRHNTALM 338 DE+LFADP F G+N ++ A M Sbjct: 671 DEALFADPVAEFAGQNIGVVIAETQKYAYM 700 >10_07_0079 + 12665141-12665167,12665613-12665702,12665783-12666310, 12666341-12667741 Length = 681 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 Query: 472 YTWGLPFGPLDITTVLLLKELPALIFPPSISLKSRFIEGICGINGIN 332 +TW + + +VL +K+ PP + ++R ++ +C IN N Sbjct: 496 WTWEKHVEAMPVLSVLHVKDCNLSHLPPGLPYQARALKRLCVINARN 542 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,565,111 Number of Sequences: 37544 Number of extensions: 286387 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -