BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00413 (523 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical ... 28 4.7 U41007-7|AAA82268.3| 516|Caenorhabditis elegans Intramembrane p... 27 8.1 >AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical protein H11E01.3 protein. Length = 1464 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +3 Query: 219 HAAHASD--EQHDESLFADPFGMFGGENHMAIMGPRHNTALMPFMPQM 356 H++HAS+ E H ESL + M G E+H + T+ P + Sbjct: 855 HSSHASEHIENHGESLQSPVASMAGSEHHNMAESSEYTTSEKEISPSI 902 >U41007-7|AAA82268.3| 516|Caenorhabditis elegans Intramembrane protease (impas)family protein 3 protein. Length = 516 Score = 27.1 bits (57), Expect = 8.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 454 FGPLDITTVLLLKELPALIFPPSISLKSRFI 362 F LD TTV+ + ++PA+I P S+ F+ Sbjct: 34 FFELDSTTVIFMDQVPAMILPFVFSIVLYFV 64 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,370,143 Number of Sequences: 27780 Number of extensions: 243972 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -