BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00408 (551 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF007193-1|AAC02271.1| 441|Homo sapiens mucin protein. 34 0.29 AF007197-1|AAB84381.1| 335|Homo sapiens mucin protein. 33 0.88 >AF007193-1|AAC02271.1| 441|Homo sapiens mucin protein. Length = 441 Score = 34.3 bits (75), Expect = 0.29 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +3 Query: 21 TRATTYVTTITDARETVLPITFRGKAILTTIVD--PTTNVITATEFVT 158 T TTY T +T TV + ++LTT+ PTTN++T T +T Sbjct: 325 TTRTTYSTNMTGTLSTVTSLRPTSSSLLTTVTATVPTTNLVTTTTKIT 372 >AF007197-1|AAB84381.1| 335|Homo sapiens mucin protein. Length = 335 Score = 32.7 bits (71), Expect = 0.88 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +3 Query: 21 TRATTYVTTITDARETVLPITFRGKAILTTIVD--PTTNVITAT 146 T TTY T +T TV + ++LTT+ PTTN++T T Sbjct: 291 TTRTTYSTNMTGTLSTVTSLRPTSSSLLTTVTATVPTTNLVTTT 334 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,531,887 Number of Sequences: 237096 Number of extensions: 980488 Number of successful extensions: 2259 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2259 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5477474182 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -