BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00403 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.57 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.1 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 9.4 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 9.4 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 9.4 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 9.4 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 9.4 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 27.1 bits (57), Expect = 0.57 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 55 LSIYLYVCFKYNSNSLCLFRICFTY--YACILETIFIYKGL 171 +SI L V ++++L + FT +AC++ IFIYK + Sbjct: 616 ISIILVVLVAVDASALVCYITRFTEENFACLIAVIFIYKAI 656 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.1 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -2 Query: 497 RQKDLFPPKSEDVLLYNYTFVFEQRKSFIVLNKMKTK*VFK*TSSL 360 R + FPP+ L + + +++F+V++K K F T++L Sbjct: 87 RMQGSFPPELASTPLEDIDSFYSNQRTFVVISKGKDIFRFSATNAL 132 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 296 YPLCERNDAICKIMVTLKRGVFLFLFSFI 210 YPLC +I+ + GV L++ +F+ Sbjct: 140 YPLCPSYRQFARILSIILIGVLLWITAFV 168 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 27 IFCSIFTFSFYTPALDY 43 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 27 IFCSIFTFSFYTPALDY 43 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 236 VFLFLFSFIDYSPATDY 186 +F +F+F Y+PA DY Sbjct: 38 IFCSIFTFSFYTPALDY 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,003 Number of Sequences: 2352 Number of extensions: 13053 Number of successful extensions: 70 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -