BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00393 (538 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 27 0.14 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 24 0.74 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 1.3 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 1.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 26.6 bits (56), Expect = 0.14 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 500 PPPSLGPAP*EQACAPPLRISCPTPRR*ASPVTV-EPPRWQRDHPPCWCGS 351 P + PAP E+ A P PTP +SP ++ E P RD P C S Sbjct: 39 PNSAASPAPPEEEAASPTPGDVPTP---SSPRSISEDPLNCRDLPNSRCNS 86 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 24.2 bits (50), Expect = 0.74 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -3 Query: 434 PTPRR*ASPVTVEPPRWQRDHPPCWCGSP 348 P+PRR A PV V RD PC G P Sbjct: 114 PSPRRVAVPVLV------RDGKPCLSGGP 136 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +2 Query: 311 QAADESERIRKALENRTNMEDDRVAILEAQLSQA 412 QA + +++A+ + + D+R+A ++AQL A Sbjct: 54 QAPKLNAEVKRAITQQHSERDERLAHVQAQLGAA 87 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.0 bits (47), Expect = 1.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 392 PRWQRDHPPCWCGSPAPCVFARIHRR 315 PR ++ HPP W C+ R RR Sbjct: 46 PRQKKSHPPQWTWQ---CINQRCERR 68 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 2.3 Identities = 13/46 (28%), Positives = 17/46 (36%) Frame = -3 Query: 503 VPPPSLGPAP*EQACAPPLRISCPTPRR*ASPVTVEPPRWQRDHPP 366 +P PS A + A P + P A V + PP PP Sbjct: 701 LPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQPP 746 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 2.3 Identities = 13/46 (28%), Positives = 17/46 (36%) Frame = -3 Query: 503 VPPPSLGPAP*EQACAPPLRISCPTPRR*ASPVTVEPPRWQRDHPP 366 +P PS A + A P + P A V + PP PP Sbjct: 593 LPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQPP 638 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 473 MEQDLEKAEERANKAIAKSL 532 +E++ ++AEE KA KSL Sbjct: 1073 LEEEKKQAEEAKRKAKQKSL 1092 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 473 MEQDLEKAEERANKAIAKSL 532 +E++ ++AEE KA KSL Sbjct: 1073 LEEEKKQAEEAKRKAKQKSL 1092 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 473 MEQDLEKAEERANKAIAKSL 532 +E++ ++AEE KA KSL Sbjct: 1073 LEEEKKQAEEAKRKAKQKSL 1092 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 473 MEQDLEKAEERANKAIAKSL 532 +E++ ++AEE KA KSL Sbjct: 1073 LEEEKKQAEEAKRKAKQKSL 1092 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,127 Number of Sequences: 336 Number of extensions: 2167 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -