BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00391 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 26 1.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.2 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 6.2 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 6.2 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 6.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.2 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 8.2 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 8.2 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQR 613 QR PQR+ QQ +Q H Q+Q+ Sbjct: 354 QRQPQRYVVAGSSQQQQQQHQQQQQK 379 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 521 LRHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 616 L+ + Q+ Q+ + + HQQ + HH+Q Q S Sbjct: 1308 LQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 622 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 622 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 622 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRQPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 98 VQYRGFEPYPSWHHGE 51 + Y GFEPY H G+ Sbjct: 1335 ISYYGFEPYERNHFGK 1350 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 622 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQLQRQQEEL 216 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 536 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 622 QR PQ F+ ++ Q Q QRQ+ L Sbjct: 260 QRQPQEFQQQQRQPQYLQPQQSQRQQEEL 288 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,996 Number of Sequences: 2352 Number of extensions: 14023 Number of successful extensions: 57 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -