BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00379 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 25 0.84 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.1 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 24 1.5 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 24 1.5 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.5 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 24.6 bits (51), Expect = 0.84 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 12/78 (15%) Frame = +2 Query: 521 EDECKSGRKKLLVDYFHTNLHTQNFYAFRFFICEVL-------NFINVVRQI-----FFM 664 E + K+ KK VD T N Y FR E+L +F +V+R I FFM Sbjct: 163 EIDVKTAMKKYSVDIISTCAFGINTYCFRNDNSEILKMATQLVDFKSVIRSISVFSFFFM 222 Query: 665 DFFLDGEFQLMAVTWSAS 718 F+D F+L V +AS Sbjct: 223 PSFVD-IFRLTFVDKTAS 239 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 10 PTRGRSARPYSRPRPTRRAPAMFDV 84 PTR +S + P P +R+P++ D+ Sbjct: 685 PTRDKSKQNEKSPSPQQRSPSVTDL 709 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 125 HTESSLRSPFTEPKTSNMAGARRVGRGREY 36 HT + P+ T G R+ RGR+Y Sbjct: 321 HTTVNEAQPYVRNTTVPTQGVARMSRGRQY 350 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 125 HTESSLRSPFTEPKTSNMAGARRVGRGREY 36 HT + P+ T G R+ RGR+Y Sbjct: 269 HTTVNEAQPYVRNTTVPTQGVARMSRGRQY 298 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 29 HVRTHDRDRRAARPPC 76 H+RTH ++R A P C Sbjct: 365 HLRTHTGEKRFACPIC 380 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,714 Number of Sequences: 336 Number of extensions: 4170 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -