BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00373 (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC290.02 |rpc34||DNA-directed RNA polymerase III complex subun... 29 0.37 SPCC4G3.09c |gyp3||GTPase activating protein Gyp3|Schizosaccharo... 25 6.1 >SPCC290.02 |rpc34||DNA-directed RNA polymerase III complex subunit Rpc34|Schizosaccharomyces pombe|chr 3|||Manual Length = 301 Score = 29.5 bits (63), Expect = 0.37 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 243 EPASDLAANKRISLLDTPVDASCQSVCGTCRLSAMMDPTVRL*P 112 E SD A+ + I + + +DA +S CG C +S + D R+ P Sbjct: 247 EKRSDGASYRAIRVNNENIDAFTESPCGNCPVSDICDANSRVNP 290 >SPCC4G3.09c |gyp3||GTPase activating protein Gyp3|Schizosaccharomyces pombe|chr 3|||Manual Length = 635 Score = 25.4 bits (53), Expect = 6.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 149 SLQVPHTDWQEASTGVSRREILL 217 SL++P TD+ ST +S+RE L Sbjct: 141 SLEIPPTDFLSTSTELSKRESCL 163 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,914,411 Number of Sequences: 5004 Number of extensions: 36596 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -