BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00371 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY302136-1|AAP57628.1| 510|Homo sapiens interferon-inducible do... 29 9.7 >AY302136-1|AAP57628.1| 510|Homo sapiens interferon-inducible double-stranded RNA-dependent protein kinase protein. Length = 510 Score = 29.1 bits (62), Expect = 9.7 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -2 Query: 296 YYHATNFASYCEFSRNSISISMLRGKPIMKAHFDEPLSQTNYKH*SLSRS 147 Y + +FA+ CE NS+ S L + + F S+ N SL+RS Sbjct: 176 YLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNRS 225 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,166,836 Number of Sequences: 237096 Number of extensions: 917771 Number of successful extensions: 1443 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1443 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -